Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Storage/Stability:
Store at -20°C . Avoid freeze / thaw cycles.
class="eg_cn_title"Immunogen:
Recombinant fusion protein containing a sequence corresponding to amino acids 200-380 of human ACTL7B (NP_006677.1). GHGVSHVVPISEGDVLPGLTSRADYAGGDLTNYLMQLLNE AGHAFTDDHLHIIEHIKKKCCYAAFLPEEELGLVPEELRVDYELPDGKLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCClonality:Polyclonal antibody
Western blot - ACTL7B Polyclonal Antibody. Western blot analysis of extracts of various cell lines, using ACTL7B antibody at 1:3000 TBST.Exposure time: 60s.