Catalog Number:

EGPS002-1, EGPS002-2

Amount:

10ug, 50ug

Other names:

Vascular Endothelial Growth Factor A; VEGFA; VEGF-A; Vascular Permeability Factor; VPF; VEGF; VEGF121

Background:

VEGF-A121 is one of five isoforms (121, 145, 165, 189, and 206) of VEGF protein, a cytokine belonging to the Platelet Differentiation Growth Factor (PDGF) family, and existing as a disulfide-linked homodimeric glycoprotein. In contrast to the longer isoforms, VEGF-A121 is more freely diffusible, and cannot bind to heparin. In vivo, VEGF is expressed predominantly in lung, heart, kidney, and adrenal glands, and the expression of VEGF is up-regulated by a number of growth factors, including PDGF, Fibroblast Growth Factor (FGF), Epidermal Growth Factor (EGF), and Tumor Necrosis Factor (TNF). VEGF signals via binding to two tyrosine kinase receptors: the Fms-like tyrosine kinase 1 (Flt-1) and the kinase domain receptor (KDR). VEGF is a specific mitogen and survival factor, contributing to abnormal angiogenesis and cancer development.

Expression system:

Vascular endothelial growth factor (VEGF)，produced in E.coli is a single non-glycosylated polypeptide chain containing 121 amino acids. A fully biologically active molecule has a molecular mass of 14 kDa. The apparent molecular mass of the protein is approximately 18kD analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques..

Species:

Human

Source:

E. coli

Amino acid sequence:

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENCDKPRR

Accession #: 

P15692-9

Molecular Weight:

14kDa, The apparent molecular mass of the protein is approximately 18kD with 6XHis tag observed by reducing SDS-PAGE.

Purity:

> 95% as analyzed by SDS-PAGE. The concentration is 0.64mg/ml.

Formulation:

Purified protein solution after extensive dialysis against PBS, pH 7.5

Endotoxin:

Less than 0.2 EU/μg determined by LAL test.

Storage/Stability:

Upon receiving, this product remains stable for up to 6 months at lower than -70°C. Upon reconstitution, the product should be stable for up to 1 week at 4°C or up to 3 months at -20°C. For long term storage it is recommended that a carrier protein (example 0.1% BSA) be added. Avoid repeated freeze-thaw cycles.

SDS-PAGE of VEGF-121 (Cat#:EGPS002).